Белка в клетке: Ошибка 404. Страница не найдена • Онлайн-школа «Фоксфорд»

0

Содержание

Ученые показали, как эволюционно древний механизм биосинтеза белка помогает клетке противостоять стрессу

Как одна и та же мРНК может направлять синтез белка в клетке четырьмя различными способами, выяснили российские ученые. Отдел науки «Газеты.Ru» рассказывает, что такое клеточный стресс и как он влияет на производство белка.

Биологи МГУ имени М.В. Ломоносова совместно с коллегами из Института молекулярной биологии имени В.А. Энгельгардта (ИМБ РАН) и Института белка РАН, применив метод трансфекции РНК, выяснили, как одна и та же мРНК может направлять синтез белка в клетке четырьмя различными способами. Результаты работы опубликованы в авторитетном журнале Scientific Reports.

Клеточный стресс и переформатирование белкового синтеза

«Наша работа посвящена изучению механизмов биосинтеза белка, в том числе в условиях клеточного стресса. В ней освещается три аспекта. Первый аспект — методический. Мы презентуем метод, позволяющий анализировать синтез белка в клетке с помощью метода краткосрочной РНК-трансфекции», — комментирует ведущий автор статьи, кандидат биологических наук, старший научный сотрудник НИИ ФХБ МГУ и ИМБ РАН Сергей Дмитриев.

Трансфекция — способ, позволяющий доставлять ДНК и РНК в живую клетку. Обычно в клетку доставляют ДНК: она проникает в ядро, запускает там процессы синтеза новых РНК, и только потом эти РНК попадают в цитоплазму и могут принять участие в получении белков. Биологи МГУ предлагают доставлять в клетку уже готовую РНК, которая сразу может служить матрицей для синтеза белка. РНК доставляется в клетку с помощью специального химического реагента. При попадании в цитоплазму она освобождается и сразу начинает участвовать в производстве белков: ей остается только встретиться с рибосомой.

Таким образом, путь до конечного продукта получается сильно короче. Уже через час-два можно наблюдать активность белка и оценивать его количество.

Этот метод позволяет изучать стрессовые воздействия на клетку на коротких временных интервалах. К клеточным стрессам относятся, например, тепловой шок, вызванный повышением температуры, окислительный стресс, спровоцированный активными формами кислорода, реакция на химические агенты, нарушающие гомеостаз, в том числе на антибиотики и терапевтические препараты. Факторы клеточного стресса вынуждают клетку приостановить биосинтез белка (либо «переформатировать» его), пока система не придёт в равновесие.

«Эти процессы обычно занимают от 1 до 4 часов, и их действие удобнее всего изучать с помощью нашего метода «быстрой» РНК-трансфекции. Мы проводили работу на культивируемых клетках почки человека — стандартном модельном объекте для подобных исследований. В результате нами была разработана методика, которая позволяет получать искусственную РНК, трансфицировать её в клетку и видеть результат через очень короткое время. Вся эта процедура была обозначена нами аббревиатурой FLERT (от англ. fleeting mRNA transfection) – немного созвучной со словом «флирт»», — улыбается Сергей.

Почему у рибосомы сумма 40S и 60S равна 80S

Матричная РНК (мРНК) — полимер из нуклеотидов, кодирующий белок. Одну аминокислоту кодируют 3 нуклеотида. Для производства белка в клетке существует специальная молекулярная машина под названием рибосома, которая, двигаясь вдоль мРНК, считывает с неё информацию тройками. Именно так, используя мРНК как матрицу, рибосома и синтезирует белок.

Машина для синтеза белка устроена очень сложно. Она состоит из двух субчастиц — малой (40S) и большой (60S). Когда они соединяются, получается целая рибосома, но она, как ни странно, обозначается не 100S, а 80S. Дело в том, что эти числа отражают не массу частицы, а коэффициент седиментации, определяемый при центрифугировании. Этот коэффициент зависит от нескольких параметров, в том числе от формы частицы.

Для того чтобы приступить к раскодированию информации, нужно сначала найти правильную точку старта — триплет, с которого предстоит начать считывание.

Обнаружить точку старта — это нетривиальная задача, поскольку триплеты в мРНК никак не обозначены. Но если начать читать не с того нуклеотида, то рамка считывания окажется сбита, и всё пойдёт вкривь и вкось.

Найти в матрице то место, с которого следует начать читать триплеты, рибосоме помогают специальные белки (факторы инициации трансляции).

Обычно в цепочке мРНК точка старта отстоит от её начала на какое-то расстояние. Часть мРНК, предшествующая стартовому кодону, именуется лидером. Этот лидер рибосома должна «проехать», не читая. Российские ученые заинтересовались вопросом, что будет, если мРНК сразу начнется со стартового кодона, с «первого слова». Интересно, что у архей (одноклеточные организмы-прокариоты, живущие на Земле миллиарды лет и способные выживать в экстремальных условиях) и у некоторых других примитивных организмов большинство мРНК начинаются прямо со стартового кодона. Такие РНК называются безлидерными. Принято считать, что безлидерные мРНК — эволюционный прообраз матричных РНК, ведь древние рибосомы ещё не умели находить стартовые точки и начинали декодирование с самого начала.

Для того чтобы рибосома связалась с мРНК и начала синтез белка, ей нужно пройти несколько стадий. Как правило, сначала с мРНК связывается 40S-субчастица рибосомы, а уже потом на стартовом кодоне к ней присоединяется большая 60S-субчастица. А вот безлидерная мРНК может связываться сразу с целой рибосомой. Это открытие сделал ещё в 90-е годы профессор МГУ имени М.В. Ломоносова Иван Шатский.

В новой работе ученые показали, что благодаря своим уникальным свойствам безлидерные РНК устойчивы ко многим видам стресса и продолжают направлять синтез белков даже в условиях, при которых обычные РНК с лидером прекращают работать в первые же минуты после воздействия.

С помощью метода FLERT это удалось показать в системе in vivo.

Все дороги хороши — выбирай на свой вкус

Продолжение работы принесло ещё более интересные результаты. Оказалось, что уникальные свойства безлидерной мРНК придают ей большую пластичность в выборе механизмов синтеза белка.

Ранее у эукариот было найдено несколько способов, с помощью которых рибосома может оказаться на стартовом кодоне. Эти способы опосредуются разным набором белков — факторов инициации трансляции — и были открыты на разных мРНК.

Самый распространенный способ, которым может воспользоваться любая клеточная мРНК, обеспечивается белком eIF2. Однако этот фактор быстро становится неактивным при любом стрессовом воздействии. В результате рибосомы перестают распознавать стартовые кодоны на всех мРНК, кроме тех, которые пользуются другими факторами инициации.

Позднее ученые обнаружили, что eIF2 — не единственный фактор, который подходит для этих целей. Например, мРНК вируса гепатита С способна обойтись без eIF2, а вместо него использовать другие факторы — eIF5B или eIF2D (это открытие также было сделано учеными МГУ имени М.В. Ломоносова ранее). Считалось, что вирус в этом плане уникален: если обычные матрицы пассивно ждут, пока с ними свяжется рибосома, то мРНК вируса гепатита С сама «хватает» 40S-субчастицу и «сажает» ее на нужное место в цепочке.Это необычное свойство и делает возможным использование альтернативных путей.

Теперь же ученые показали, что безлидерная мРНК способна делать то же самое.

Интересно, что фактор eIF5B есть у всех организмов — это эволюционно консервативный белок. А классический eIF2 присутствует только у эукариот, у высших организмов, т.е. он универсальным не является. Совокупность упомянутых работ позволяет сказать, что хорошо изученный классический фактор eIF2 нужен только тогда, когда рибосомы узнают мРНК посредством поиска стартового кодона. Такой способ инициации трансляции называется сканированием, именно для него и нужен eIF2. Когда стартовый кодон найден, на место eIF2 приходит eIF5B и начинается биосинтез белка. Эволюционно более древняя безлидерная мРНК может использовать примитивный механизм, сразу привлекая фактор eIF5B.

«У нас получился красивый результат, который сразу всё объяснил. Мы обнаружили, что примитивная РНК может использовать эволюционно древний механизм. А кроме того, она умеет пользоваться и тремя остальными путями: через eIF2, eIF2D или прямое связывание целой 80S рибосомы», — заключает Сергей Дмитриев.

Исследования поддержаны грантом Российского научного фонда (РНФ).

Ученые выяснили, как синтез белка влияет на старение

https://ria.ru/20200706/1573957800.html

Ученые выяснили, как синтез белка влияет на старение

Ученые выяснили, как синтез белка влияет на старение – РИА Новости, 06.07.2020

Ученые выяснили, как синтез белка влияет на старение

Биологи из Московского государственного университета совместно с коллегами из Гарвардской школы медицины изучили, как меняется с возрастом биосинтез белка в… РИА Новости, 06.07.2020

2020-07-06T14:46

2020-07-06T14:46

2020-07-06T14:47

наука

мгу имени м. в. ломоносова

российская академия наук

открытия – риа наука

здоровье

биология

старение

/html/head/meta[@name=’og:title’]/@content

/html/head/meta[@name=’og:description’]/@content

https://cdnn21.img.ria.ru/images/148823/03/1488230305_0:270:5184:3186_1920x0_80_0_0_f8f200a853bd5b5b9af5d31a6908cd98.jpg

МОСКВА, 6 июл — РИА Новости. Биологи из Московского государственного университета совместно с коллегами из Гарвардской школы медицины изучили, как меняется с возрастом биосинтез белка в органах мышей. Это дает понимание одного из фундаментальных механизмов процесса старения. Результаты исследования опубликованы в журнале Proceedings of the National Academy of Sciences.В основе старения лежат повреждения, которые со временем накапливаются в клетках, тканях и органах живых организмов. Биосинтез белка — важнейший метаболический процесс, на который клетка тратит большую часть вырабатываемой энергии. Его нарушения вносят большой вклад в старение организма в целом.Известно, что некоторые воздействия, снижающие эффективность белкового синтеза, увеличивают продолжительность жизни животных. Например, при отсутствии аминокислот — когда животное голодает — или в условиях, способствующих денатурации белков — при перегреве или интоксикации — уровень синтеза белка падает, и эта адаптация позволяет организму выжить в неблагоприятных условиях.Эффект замедления синтеза белка, продлевающий жизнь, возникает в организмах некоторых животных при низкокалорийной диете или применении лекарственных средств, снижающих активность одного из главных регуляторов белкового синтеза — протеинкиназы mTOR.Авторы выяснили, что с возрастом в печени и почке мышей происходит нечто похожее: стареющие клетки, как бы чувствуя накопление повреждений, снижают уровень белкового синтеза, чтобы отсрочить наступление неблагоприятных последствий. Задачей ученых было понять механизм этого процесса. Исследованием изменений, происходящих с возрастом в различных организмах — от дрожжей до человека — ученые из НИИ Физико-химической биологии имени А.Н. Белозерского МГУ занимаются с 2017 года. Главным проектом лаборатории стало изучение картины биосинтеза белка в органах мышей разного возраста методом рибосомного профайлинга. “Этот ультрасовременный метод появился относительно недавно и совершил настоящую революцию, привнеся все преимущества системной биологии в область изучения биосинтеза белка, — приводятся в пресс-релизе МГУ слова Сергея Дмитриева, одного из авторов исследования, старшего научного сотрудника НИИ ФХБ МГУ и ИМБ РАН. — В клетке белок синтезируют специальные молекулярные машины – рибосомы. Они “переводят” (транслируют) последовательности генов с языка азотистых оснований, на котором записана информация в ДНК и РНК, на язык аминокислот, из которых и состоят белки. Метод рибосомного профайлинга позволяет определить одновременно все РНК, которые в данный конкретный момент транслируются рибосомами в клетке. Для этого используется секвенирование нового поколения и сложная биоинформатическая обработка данных”.Как биохимическую, так и “компьютерную” части исследования выполняли в МГУ с учетом опыта американских коллег.Выпускница факультета биоинженерии и биоинформатики МГУ Александра Анисимова, первый автор статьи, рассказывает: “Благодаря уникальному опыту, накопленному в лаборатории Вадима Гладышева в Бостоне, мы смогли применить метод рибосомного профайлинга к двум органам — печени и почке — мышей разного возраста. Это позволило детально охарактеризовать изменения в экспрессии генов на уровне биосинтеза белка при старении. Мы обнаружили изменения в синтезе компонентов многих важных процессов и регуляторных путей, в том числе связанных с иммунитетом, воспалением, внеклеточным матриксом и метаболизмом жиров. Но самое яркое наблюдение, которое мы сделали, касается снижения темпов наработки самих компонентов белок-синтезирующего аппарата — рибосомных белков и трансляционных факторов”.”Полученные результаты помогают понять фундаментальные механизмы, лежащие в основе процессов старения. Одновременно мы узнаем много нового о молекулярных механизмах биосинтеза белка”, — отмечает один из руководителей работы, профессор Гарвардской школы медицины Вадим Гладышев.В настоящее время ученые продолжает исследования с целью выяснения, какие именно воздействия на организм мышей приводят к увеличению продолжительности жизни.

https://ria.ru/20200428/1570662373.html

https://ria.ru/20200310/1568379308.html

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

2020

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

Новости

ru-RU

https://ria.ru/docs/about/copyright.html

https://xn--c1acbl2abdlkab1og.xn--p1ai/

РИА Новости

[email protected]

7 495 645-6601

ФГУП МИА «Россия сегодня»

https://xn--c1acbl2abdlkab1og.xn--p1ai/awards/

Биологи МГУ узнали, как в живой клетке начинается синтез белка – Наука

Без гидролиза сборка белковой молекулы невозможна. Этот процесс ученые назвали «слайдингом», сообщает пресс-служба МГУ им М.В. Ломоносова. Исследование биологов под руководством Сергея Дмитриева опубликовано в журнале Nucleic Acids Research.

Существенная доля нашей генетической информации, закодированной в ДНК, реализуется в живой клетке в виде белков. Для того чтобы синтезировать нужный белок, эту информацию нужно перевести из последовательности нуклеотидов на язык аминокислот. В этой стадии преобразования участвует матричная РНК — «временный носитель», на котором находится копия одного конкретного гена. Специальная молекулярная машина — рибосома — движется по матричной РНК и считывает тройки нуклеотидов, каждая из которых кодирует ту или иную аминокислоту.

Таким образом, рибосома должна определить, с какого места ей необходимо начинать считывание. Если же первая тройка нуклеотидов будет выбрана неверно, рибосома начнет синтезировать неправильный белок, который окажется бесполезным или даже токсичным для клетки.

Для решения этой проблемы существует специальный механизм — рибосомное сканирование. Сначала малая субчастица рибосомы, нагруженная специальными белками, связывается с концом матричной РНК, которая играет роль «инструкции» по сборке белковой молекулы. Затем рибосома начинает перемещаться по мРНК, «просматривая» один за другим все встречающиеся ей тройки нуклеотидов. Как правило, в качестве точки старта используется тройка нуклеотидов AUG. Когда рибосома находит его, она останавливается и начинает синтез белка. Ранее считалось, что обнаружение AUG — единственное и важнейшее событие, приводящее к началу синтеза с нужной точки.

Когда малая субчастица встречает тройку нуклеотидов AUG, она может начать сборку белковой молекулы (инициировать трансляцию), а может и не начать. Это зависит от того, какой набор белков-помощников будет в ее распоряжении. Эти специальные белки так и называются — факторы инициации трансляции (сокращенно — eIF). Они имеют номера: так, у эукариот (организмов с ядром в клетке, к которым также относится человек) один из самых важных факторов — второй (eIF2). Он вместе с транспортной РНК привозит первый «кирпичик» белка — аминокислоту метионин. В конце к малой субчастице рибосомы должна присоединиться еще и большая. Когда все компоненты есть в клетке в нужных количествах, происходит гидролиз (разложение) молекулы гуанозинтрифосфата (ГТФ), что и служит сигналом к началу трансляции. Молекула ГТФ связана с фактором трансляции eIF2, но сам eIF2 гидролизовать ГТФ не может — для этого ему нужен еще один белок-помощник, eIF5. Наличие eIF5 в необходимой концентрации как раз и определяет, гидролизуется ли ГТФ.

«Как оказалось, если гидролиза не произойдет, то малая субчастица проигнорирует стартовый кодон AUG и проскользнет дальше, как ни в чем не бывало. Мы назвали это слайдингом», – говорит Сергей Дмитриев.

Открытие слайдинга опровергает устоявшееся мнение о том, что процесс выбора точки начала трансляции заканчивается на моменте распознавания точки старта синтеза. Решающим событием является не узнавание AUG, а гидролиз ГТФ.

Клеточный транспорт

Раздел посвящённый процессу клеточного транспорта, который принимает участие во многих сферах жизнедеятельности клетки.

Пути транспорта белков в клетке

Пути транспорта в клетке

Синтез белка всегда начинается в цитоплазме. Окончание синтеза происходит в цитоплазме либо на шероховатом эндоплазматическом ретикулуме (ШЭР).
Можно условно выделить два пути транспорта белка в клетке:
1. Из цитоплазмы в некоторые органеллы (ядро, пластиды, митохондрии)
2. Большой путь везикулярного транспорта из ШЭР через аппарат Гольджи (АГ) к другим органеллам (лизосомы, пероксисомы) и через секреторные везикулы во внеклеточную среду. Поскольку синтез всех белков начинается в цитоплазме, а конечная локализация каждого белка может быть различна внутри полипептида имеется система сигналов определяющая его транспортный путь. Первичный сигнал определяет путь из цитоплазмы (в ШЭР, в ядро, в митохондрию или в пластиду), вторичный сигнал определяет дальнейшее направление, например, внешняя или внутренняя мембрана митохондрии или матрикс; лизосома, пероксисома или секреторная гранула.

Сигнальные последовательности белков

Сигнальные последовательности имеют длину 3-80 аминокислот узнаются специфическими рецепторами на мембранах различных компартментов клетки.

Сигнальная последовательность ЭР – гидрофобный участок 5-15 аминокислот на N-конце полипептида.
Сигнал митохондриальных белков 20-80 аминокислот состоящий из спирали и торчащих концов – (+)-заряженного и гидрофобного. 5 (+)-заряженных аминокислот для транспортировки в ядро. Пероксисомные белки имеют последовательность на С-конце Ser-Lys-Leu-COOH.
Имеется класс сигнальных последовательностей которые не позволяют белку достигшему определенной локализации транспортироваться дальше. Например, мотив Lys-Asp-Glu-Leu-COOH (KDEL) не позволяет белкам покидать эндоплазматический ретикулум.

Одна из функций гладкого ЭР – удержание кальция готового для выпуска в цитозоль при стимуляции клетки. Кальретикулин – белок удерживающий ионы кальция. Первые 17 аминокислот включают 14 гидрофобных (синие) – сигнальная последовательность для проникновения в ЭР из цитозоля. Последние четыре аминокислоты KDEL удерживают белок в ЭР.

(Nh3)MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKF
YGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFP
NSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRP
DNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKP
EDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQI
DNPDYKGTWIHPEIDNPEYSPDPSIYAYDNF
GVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
KEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL(COOH)

]]>сервер для предсказания сигнальных последовательностей белков]]>
Некоторые белки имеют различные локализации в клетки. Существует несколько путей транспортировки идентичных полипептидов в различные компартменты клетки [Karniely, 2005]:
1. Несколько сигнальных последовательностей в одном полипептиде преднозначенные для разных компартментов. Каталаза А дрожжей имеет две сигнальные последовательности – для митохондрий и пероксисом, причем количество фермента в этих органеллах зависит от состава среды. Некоторые цитохромы имеют два сигнала – митохондриальный и ЭР. Митохондриальный сигнал запускается после посттрансляционного фосфорилирования белка. Известно, что белок-предшественник амилоида болезни Альцгеймера также имеет два сигнала локализации – ЭР и митохондрий.
2. Одна сигнальная последовательность узнается различными рецепторами на поверхности компартментов. Например, некоторые белки митохондрий и хлоропластов имеют общую сигнальную последовательность, которая более гидрофобна чем специфические сигналы.
3. Сигнал может быть блокирован другим белком. Апуриновая/апиримидиновая эндонуклеаза 1 (Apn1) – основной фермент эксцизионной репарации репарации ДНК в ядре и митохондриях. С-конец имеет сигнал ядерной локализации (NLS), за которым идет сигнал митохондриальной локализации. белок Pir1 взаимодействует с С-концом Apn1 блокируя NLS.
4. Сигнал может быть блокирован специфическим сворачиванием белка. Аденилат-киназа дрожжей Aky2 локализуется в цитоплазме и в небольшом количестве в межмембранном пространстве митохондрий, имеет две сигнальные последовательности, активность которых зависит от конформации белка.
5. Сигнал может быть блокирован после модификации полипептида. Фосфорилированный цитохром CYP2B1, взаимодействует с цитозольным шапероном Hsp70, что приводит к конформационным изменениям и переключает одну сигнальную последовательность на другую.
6. Одна РНК может иметь два сайта инициации трансляции при этом образуются два белка – один с сигнальной последовательностью, другой без нее, что определит различную локализацию белков в клетке. В другом случае может образовываться две различные РНК кодирующие два идентичных белка, но у одного будет сигнальная последовательность, а у другого нет.

Транспорт в ядро

Транспорт в митохондрии и пластиды

Митохондрии и пластиды имеют собственную ДНК и самостоятельно синтезируют некоторые белки. Однако многие из основных белков митохондрий и пластид синтезируются в цитозоле.
Белки проникающие в митохондрии должны нести сигнал, определяющий локализацию – внутрення или наружная мембрана, или матрикс.
Белки преднозначенные для матрикса несут сигнал на N-конце, который узнается рецепторами на внешней мембране. Рецептор связан с комплексом переноса белка, который разворачивает белок и переносит его через мембрану. После переноса белка сигнальная последовательность отрезается и белок снова сворачивается.
Белки шапероны связываются с вновь синтезированным белком предотвращая его сворачивание.
Шаперонины связываются с белком после его транспортировки к месту доставки и способствуют правильному сворачиванию.
В ответ на различные стрессовые воздействия (например повышение температуры) в клетке синтезируются шапероны называемые белками теплового шока – hsp (heat-shock proteins), которые стабилизируют клеточные белки. Hsp обнаружены во всех клеточных компартментах эукариот и у бактерий.

Везукулярный транспорт


Из одной органеллы в другую перемещение происходит в везикуле или на ее поверхности в виде интегральных белков.
Донорый компартмент – органелла от которой отрывается мембрана в составе везикулы, акцепторный компартмент – принимает везикулу.
конститутивная секреция – происходит постоянно и не зависит от внешних сигналов.
регулируемая секреция – под ПМ происходит накопление пузырьков, которые сливаются с ПМ при наличии внешних сигналов – гормоны, нервы – и повышении конц. Ca2+ до 1мкм
ретроградный транспорт – возвращение рецепторных белков и липидов из АГ в Эр – восполнение мембраны ЭР.
антероградный транспорт – растворимые грузовые белки двигаются по секреторному пути ЭР→ пузырек?цис-Гольджи?пузырек?транс-Гольджи?пузырек?органелла или секреция
Окаймленные везикулы – покрыты белками, кот узнают и концентрируют специфич. м-ные белки и отделяют м-ну пузырька, формируют решетку и придают форму везикуле: клатриновые, COPI, COPII:
Клатриновые везикулы – ~0,1мкм, транспорт из АГ и ПМ,клатрин – 3типа, 3 большие и 3 малые субъединицы формирующие трискелетон – собирающиеся на поверхности м-ны со стороны цитоплазмы в пента- и гексагоны, кот спонтанно формируют сферу. Адаптин – связывает клатрин с м-ной и ловит различные трансм-ные белки в том числе грузовые рецепторы, кот. захватывают р-римые грузовые белки, кот попадают внутрь везикулы. Имеетя по крайней мере 4 типа адаптинов
динамин – GTP-аза, р-римый цитоплазматический белок, образует кольцо на отделяющейся клатриновой везикуле – регулирует кол-во клатрина отщепляющееся вместе с м-ной в составе везикулы, ассоциирует другие белки помогающие выпучить м-ну и белки модификаторы липидов, изменяющие локально липидный состав м-ны для выпучивания
После отделения везикулы от м-ны клатрин и адипин отделяют шапероны – ATP-азы hsp70 семейства. Ауксилин – прикрепляется к везикуле и активирует АТФ-азу. Т.к кайма формирующейся везикулы сущ. дольше чем кайма отделенной – имеется стабилизирующий механизм. Клатриновая оболочка обеспечивает значительную силу для изгибания м-ны, т.к. везикулы из внутриклеточных компартментов образуются на уже выпученной м-не
COP-I – транспорт от АГ и ЭР, 8субъединиц, GTP-белок – фактор рибозилирования АДФ –ARF – транспорт
COP-II – транспорт из АГ и ЭР, 5 субъединиц
Везикулы мб не только сферические, часто образуются трубчатые везикулы в которых высокое соотношение S/V
Образование клатриновых и COP везикул регулируется GTP-связывающими белками, которые могут находится в активном GTP- и неактивном GDP-состоянии
Два класса белков обменивают GDP-GTP: GEF-гуанин-нуклеотид-фактор обмена активирует белки заменяя GDF?GTF, GAP- белок активирующий GTP-азы – инактивирует GTP-связывающие белки меняя GTP?GDP.
GTP-азы необходимые для сборки окаймленных везикул перед сборкой пузырьков: мономерные GTP-связывающие белки (GTP-азы):
ARF-белки – необх для клатриновой и COP сборки на пов-ти м-ны АГ. Sar1 белок, необходим для COPII сборки на на ЭР м-не
тримерные (G белки).
GTP-азы находятся в цитозоле в неактивном состоянии, перед сборкой GEF встраивается в м-ну ЭР и связывает цитозольный SarI, кот обменивает GDF?GTP. В GTP состоянии SarI встраивается остатком жирной к-ты в м-ну ЭР. Ассоциирует белки об-ки и инициирует отпочковывание везикулы. GTP-азы попавшие в м-ну активируют фосфолипазу D, кот преобразует фосфолипиды в фосфотидную к-ту, что усиливает связывание оболочных белков. Вместе белок-белковые и белок-липидные взаимодействия изгибают м-ну
SNARE – белки – отвечают за слияние донорной и акцепторной м-н, более 20, каждая на специфич пов-ти м-ны, трансмембранные белки на пов-ти везикулы – v-SNAR, на пов-ти донора – t-SNAR. Взаимодействуя v- и t-SNAR обвиваются др на друга в транс-SNAR-комплекс, обеспечивающий слияние м-н. SNF-белок разрушает транс-SNAR-комплексы – цитозольный шаперон ATP-аза, использует адаптирующие белки для связывания с комплексом-SNAR
Rab-белки – мономерные GTP-азы, более 30, каждая органелла имеет хотя бы один Rab на м-не со стороны цитоплазмы, регулируют стыковку везикул и связывание v-SNAR-ов и t-SNAR-ов необходимых для слияния м-н. В состоянии GDP-не активны, нах в цитозоле, в состоянии GTP-активны и переходят на пов-ть м-ны органеллы или везикулы. В активном состоянии Rap связываются с м-ной липидным якорем и собирают другие белки участвующие в слиянии м-н
неактивный Rab-GDP связан с GDI – GDP-диссоциирующий ингибитор. Rab-GDP связывается с GEF-гуанин нуклеотид меняющий фактор, связанный с м-ной донорного компартмента – меняет GDP на GTP. Rab-GTP связывается с м-ной формирующейся везикулы и ассоциирует v-SNARE, которые в составе везикулы транспортируются к органелле и связываются с Rab-эффекторами и t-SNARE, связанными с м-ной акцепторного компартмента и обеспечивают слияние м-н
белок органелла
Rab1 ЭР и АГ
Rab2 цис-АГ
Rab3A синаптич везикулы, секрет гранулы
Rab4 ранние эндосомы
Rab5A ПМ, клатриновые везикулы
Rab5C ранние эндосомы
Rab6 промежуточный- и транс-АГ
Rab7 поздние эндосомы
Rab8 секреторные везикулы (базолатеральные)
Rab9 поздние эндосомы, trans-АГ
Слияние м-н происходит не только при везикулярном транспорте: слияние спермия с яйцом, слияние миобластов во время развития мышечной клетки.

Образование клатринового пузырька. Диаметр клатринового пузырька ~0,3 мкм
клатриновая везикула

ТРАНСПОРТ ЧЕРЕЗ МЕМБРАНУ МАЛЫХ МОЛЕКУЛ

унипорт-независимый перенос, симпорт-одновременный, однонаправленный перенос, антипорт-одновременно антинаправленный транспорт | симпорт и антипорт – контранспорт – скорость процесса зависит от двух переносимых в-в
пассивный транспорт – идущий по градиенту концентрации и/или по электрическому градиенту – простая диффузия, канальный транспорт, облегченная диффузия
простая диффузия – липидная м-на обладает малой проницаемостью для ионов и большинства полярных молекул (исключение вода). Неполярные диффундируют Н2О, CO2, O2. Коэффициенты проницаемости для низкомолекулярных соединений коррелируют с отношением их растворимости в неполярных растворителях к растворимости в воде. Эта зависимость дает основание думать, что низкомолекулярные соединения проходят сквозь двуслойную липидную мембрану следующим образом: сначала они теряют окружающую их гидратную оболочку, затем растворяются в углеводородном внутреннем слое мембраны, после чего диффундируют через этот внутренний слой к другой стороне мембраны, где вновь растворяются в воде.
каналы – трансм-ные белки формирующие в м-не сквозные проходы – индиферентные (всегда открыты – каналы чувствительные к давлению), аллостерические (химически регулируемые – при наличии лиганда никотиновый ацетилхолиновый рец-р, рец-р -аминомаслянной к-ты, рец-р глицина) и потенциал-зависимые (при изменении м-ного потенциала Na+-канал, K+-канал, Ca2+-канал)
облегченная диффузия осущ белками переносчиками, кот специфич связывают и переносят молекулы через липидный бислой, путем изменения конформации
активный транспорт – требующий затрат энергии:
первично-активные -непосредственно использует энергию- сопряженные с ох-red р-циями (цитохром с-оксидаза), сопряженные с поглощ. hv (бактериородопсин), АТФ-азы (Na+/K+-АТФ-аза, Ca2+-АТФ-аза, Н+-АТФ-аза, K+-АТФ-аза, H+/K+-АТФ-аза
вторичноактивные по градиенту, созданному в процессе первично-активного транспорта – контранспорты – симпортеры (лактозопермеаза), антипортеры (белок полосы 3)
транспорт некоторых сахаров и аминокислот внутрь животных клеток обусловливается градиентом Na+ через плазматическую мембрану. Всасывание глюкозы в клетки кишечника и почек достигается с помощью системы симпорта, в которой глюкоза и ионы Na+ связываются с различными участками на белке-переносчике глюкозы (рис. 56). Na+ стремится войти в клетку по своему электрохимическому градиенту и как бы “тащит” глюкозу внутрь за собой. Чем выше градиент Na+, тем больше скорость всасывания
глюкозы. И наоборот, если концентрация Na+ во внеклеточной жидкости заметно уменьшается, транспорт глюкозы останавливается. Ионы Na+, проникающие в клетку вместе с глюкозой, выкачиваются обратно Na+,К+-АТФазой, которая, поддерживая градиент концентрации Na+, косвенным путем контролирует транспорт глюкозы. В плазматических мембранах многих животных клеток существует, по крайней мере, 5 различных белков переносчиков аминокислот, которые действуют как системы симпорта, перенося одновременно ионы Na+, причем каждый из этих белков специфичен для группы родственных аминокислот. У бактерий большинство систем активного транспорта, приводящихся в действие ионными градиентами, использует в качестве котранспортируемого иона Н+, а не Na+. В частности, активный транспорт большей части сахаров и аминокислот в бактериальные клетки обусловлен градиентом Н+ через плазматическую мембрану. Наиболее хорошо изученный пример такого рода – это трансмембранный белок переносчик лактозы (пермеаза, или М-белок), состоящий из одной полипептидной цепи (30 кДа) и осуществляющий Н+-зависимый симпорт: с каждой транспортируемой в клетку молекулой лактозы переносится один протон.

векторный транспорт – способ активного транспорта – молекулы, проникшие в клетку пассивно, химически модифицируются с затратой энергии, так что модифицированные молекулы уже не могут выйти обратно через тот же канал. Встречается у бактерий при транспорте сахаров: при переносе через плазматическую мембрану сахара фосфорилируются, становятся заряженными и не могут выйти обратно, поэтому они начинают накапливаться в клетке. При этом концентрация нефосфорилированных сахаров внутри клетки остается очень низкой, и сахара продолжают поступать в клетку по градиенту концентрации. Механизм сопряженного с транспортом фосфорилирования сахаров у бактерий довольно сложен: в нем участвуют, по крайней мере, четыре разных мембранных белка, а в качестве донора фосфатной группы используется не АТФ, а фосфоенолпируват

ТРАНСПОРТ ЧЕРЕЗ МЕМБРАНЫ МАКРОМОЛЕКУЛ

ТРАНСПОРТ БЕЛКОВ через мембраны
пориновый комплекс – 125000кДа транспорт ч-з ядерную м-ну цитозольных белков, сигнальные посл-ти связ с пк и переносятся с сохранением третичной стр-ры
белки-переносчик – транспорт из цитоплазмы в органеллы, белковые комплекся переносятлинейные пептиды ч-з биомембраны энергозависимым образом посредством связывания сигнальной посл-ти с рецептором, разворачивание и сворачивание белка контролируется шаперонами

Синтез белка в митохондриях может происходить без ключевого компонента

Ученые с кафедры молекулярной биологии МГУ, под руководством младшего научного сотрудника Антона Кузьменко, совместно с коллегами из Швеции, обнаружили, что синтез белка в митохондриях пекарских дрожжей может проходить без участия одного из трех компонентов, которые до сих пор считались совершенно необходимыми для безъядерных клеток. Об этом открытии, полные результаты которого опубликованы в журнале Scientific Reports, рассказывается в пресс-релизе Московского университета.

Белки в живой клетке синтезируются в соответствии с кодом матричной РНК (рибонуклеиновой кислоты), которая, в свою очередь, является «слепком» с нужного участка ДНК. Происходит процесс синтеза белка в особой органелле клетки — рибосоме. Активируют процесс синтеза специальные белки — факторы трансляции. У прокариот, то есть у организмов, клетки которых не имеют ядер (это бактерии и археи) факторов трансляции обнаружено три: IF1, IF2 и IF3. Что же касается эукариот — организмов с ядрами в клетках, в том числе и мы с вами — число этих факторов превышает 20.

Митохондрии — органеллы, «энергетические станции» наших клеток — теоретически должны были бы синтезировать белки как прокариоты. Дело в том, что, согласно господствующей сейчас в науке теории, митохондрии как раз и были когда-то самостоятельными одноклеточными безъядерными организмами, наподобие бактерий, которых наши опять же одноклеточные, но уже эукариотические предки «проглотили», но, вместо того, чтобы переварить, поставили себе на службу. (См. также наш материал «Митохондрии: путь от паразита до благодетеля».) В результате, у митохондрий остались многие черты самостоятельных организмов: собственная ДНК, и даже свои рибосомы, в которых тоже происходит синтез белка.

Ранее у митохондрий было открыто три белка-фактора трасляции: mtIF1, mtIF2 и mtIF3. Казалось бы, все «шло по плану», полностью согласуясь с теорией. Однако эксперимент ученых из Московского университета, имевший своей целью доказать, что фактор mtIF3 (идентифицированный позже других) так же необходим для синтеза белка, как и первые два, дал неожиданный результат.

Молекулярные биологи «вырезали» из митохондриальной ДНК пекарских дрожжей ген, кодирующий белок mtIF3, а на его место вставили ген устойчивости к антибиотику, добавленному к питательной среде, чтобы все клетки, в которых ген остался, погибли. К удивлению ученых, митохондрии выживших клеток, не имевшие третьего фактора трансляции, продолжали успешно синтезировать белки.

«Биосинтез белка в этих условиях шел, в целом, примерно с той же эффективностью, что и в нормальных дрожжевых митохондриях, но был сильно “разбалансирован”. Другими словами, некоторых митохондриальных белков в отсутствие mtIF3 действительно становилось меньше, зато количество других вырастало в несколько раз!» — рассказал ведущий научный сотрудник Петр Каменский, один из основных авторов исследования.

Скорее всего, предполагают теперь ученые, mtIF3 имеет и другие функции в клетке —  координирует соотношение производимых в митохондриях белков. Поскольку ранее была установлена связь между нарушением такой координации и развитием болезни Паркинсона, это открытие, возможно, поможет лучше разобраться в механизмах этой болезни и разработать новые методы ее лечения.

Кроме того, открытие ученых из МГУ открывает дорогу к более точному моделированию системы митохондриальной трансляции in vitro ( «в пробирке»). Такие модели, разработанные для эукариотических и бактериальных клеток, уже некоторое время помогают ученым тестировать лекарства (включая новые антибиотики) и ставить другие важные эксперименты.

[Публикация подготовлена Центром популяризации научных знаний МГУ им. М.В. Ломоносова]

Синтез белков в клетке

Биосинтез белков идет в каждой живой клетке. Наиболее активен он в молодых растущих клетках, где синтезируются белки на построение их органоидов, а также в секреторных клетках, где синтезируются белки-ферменты и белки-гормоны.

Основная роль в определении структуры белков принадлежит ДНК. Отрезок ДНК, содержащий информацию о структуре одного белка, называют геном. Молекула ДНК содержит несколько сотен генов. В молекуле ДНК записан код о последовательности аминокислот в белке в виде определенно сочетающихся нуклеотидов. Код ДНК удалось расшифровать почти полностью. Сущность его состоит в следующем. Каждой аминокислоте соответствует участок цепи ДНК из трех рядом стоящих нуклеотидов.

Например, участок Т—Т—Т соответствует аминокислоте лизину, отрезок А—Ц—А — цистину, Ц—А—А — валину н т. д. Разных аминокислот — 20, число возможных сочетаний из 4 нуклеотидов по 3 равно 64. Следовательно, триплетов с избытком хватает для кодирования всех аминокислот.

Синтез белка — сложный многоступенчатый процесс, представляющий цепь синтетических реакций, протекающих по принципу матричного синтеза.

Поскольку ДНК находится в ядре клетки, а синтез белка происходит в цитоплазме, существует посредник, передающий информацию с ДНК на рибосомы. Таким посредником является и-РНК.     :

В биосинтезе белка определяют следующие этапы, идущие в разных частях клетки:

  1. Первый этап — синтез и-РНК происходит в ядре, в процессе которого информация, содержащаяся в гене ДНК, переписывается на и-РНК. Этот процесс называется транскрипцией (от лат. «транскриптик» — переписывание).
  2. На втором этапе происходит соединение аминокислот с молекулами т-РНК, которые последовательно состоят из трех нуклеотидов — антикодонов, с помощью которых определяется свой триплет-кодон.
  3. Третий этап — это процесс непосредственного синтеза полипептидных связей, называемый трансляцией. Он происходит в рибосомах.
  4. На четвертом этапе происходит образование вторич ной и третичной структуры белка, то есть формирование окончательной структуры белка.

Таким образом, в процессе биосинтеза белка образуются новые молекулы белка в соответствии с точной информацией, заложенной в ДНК. Этот процесс обеспечивает обновление белков, процессы обмена веществ, рост и развитие клеток, то есть все процессы жизнедеятельности клетки.

Хромосомы (от греч. «хрома» — цвет, «сома» — тело) — очень важные структуры ядра клетки. Играют главную роль в процессе клеточного деления, обеспечивая передачу наследственной информации от одного поколения к другому. Они представляют собой тонкие нити ДНК, связанные с белками. Нити называются хроматидами, состоящими из ДНК, основных белков (гистонов) и кислых белков.

В неделящейся клетке хромосомы заполняют весь объем ядра и не видны под микроскопом. Перед началом деления происходит спирализация ДНК и каждая хромосома становится различимой под микроскопом. Во время спирализации хромосомы сокращаются в десятки тысяч раз. В таком состоянии хромосомы выглядят как две лежащие рядом одинаковые нити (хроматиды), соединенные общим участком — центромерой.

Для каждого организма характерно постоянное количество и структура хромосом. В соматических клетках хромосомы всегда парные, то есть в ядре есть две одинаковые хромосомы, составляющие одну пару. Такие хромосомы называют гомологичными, а парные наборы хромосом в соматических клетках называют диплоидными.

Так, диплоидный набор хромосом у человека состоит из 46 хромосом, образуя 23 пары. Каждая пара состоит из двух одинаковых (гомологичных) хромосом.

Особенности строения хромосом позволяют выделить их 7 групп, которые обозначаются латинскими буквами А, В, С, D, Е, F, G. Все пары хромосом имеют порядковые номера.

У мужчин и женщин есть 22 пары одинаковых хромосом. Их называют аутосомы. Мужчина и женщина отличаются одной парой хромосом, которые называют половыми. Они обозначаются буквами — большая X (группа С) и маленькая Y (группа С,). В женском организме 22 пары аутосом и одна пара (XX) половых хромосом. У мужчин — 22 пары аутосом н одна пара (XY) половых хромосом.

В отличие от соматических клеток, половые клетки содержат половинный набор хромосом, то есть содержат по одной хромосоме каждой пары! Такой набор называют гаплоидным. Гаплоидный набор хромосом возникает в процессе созревания клеток.


Биофизики пролили свет на белковые взаимодействия — МФТИ

Иллюстрация. Лампочка для белков. Дизайнер Дарья Сокол, пресс-служба МФТИ

Биофизики из МФТИ разработали новый способ детекции белок-белковых взаимодействий в живых клетках. Результаты работы опубликованы в журнале ACS Synthetic Biology

Чтобы увидеть конкретный белок в клетке, недостаточно просто посмотреть в микроскоп, так как типичный размер белков составляет порядка 10 нм, что во много раз меньше длины волны видимого света, а большинство белков при этом являются бесцветными. Для решения этой задачи нужно как-то пометить интересующий нас белок. Один из способов — генетически прикрепить к нему (т. е. внести изменения в его последовательность ДНК) флуоресцентный белок, который будет светиться при воздействии светом определенной длины волны. Наиболее часто используется всем известный GFP (Green Fluorescent Protein), однако он работает не при любых условиях. В качестве альтернативы могут быть использованы так называемые LOV-домены. Один из таких белков был разработан ранее учеными из МФТИ.

Задача усложняется, если хочется не просто посмотреть на один белок, а обнаружить взаимодействия двух разных. Один из возможных подходов — это использовать так называемые разделенные (по-английски — split) белки.

 

Рисунок 1. Три способа разреза флуоресцентного LOV-домена. Синими и оранжевыми спиралями показаны модельные взаимодействующие белки. Серым показаны части флуоресцентного белка до взаимодействия. Зеленым показан светящийся LOV-домен. FMN (флавинмононуклеотид) — молекула, которая нужна для поглощения и испускания света. Источник: ACS Synthetic Biology. Copyright (2021) American Chemical Society

«Представьте, что мы разделили лампочку на две части и дали эти части двум людям. Когда два человека подойдут друг к другу (и только в этом случае), лампочка соберется из двух половинок и начнет светиться. В нашем случае два человека — это два белка, про которых мы хотим узнать, взаимодействуют ли они в клетке, и если да, то в какой именно ее части. А лампочка — это светящийся белок, который разделили на две части и  прикрепили их к исследуемым белкам», — прокомментировала Анна Юденко, сотрудник Центра исследования молекулярных механизмов старения и возрастных заболеваний МФТИ. 

Однако подобрать такие части белка, которые после разделения смогут снова собраться и флуоресцировать, — большая работа. По отдельности части белка могут быть нестабильны или выпадать в осадок или наоборот связываться друг с другом слишком сильно.

Чтобы уменьшить риски, ученые  в первую очередь провели биоинформатический анализ, который показал наилучшие места для разрезания флуоресцентного белка. После этого было создано несколько десятков генетических конструкций, в которых соединили последовательности ДНК, кодирующие модельные белки и половинки флуоресцентного белка. В результате были найдены наилучшие варианты, которые давали хороший сигнал как на бактериальных клетках — кишечной палочки — так и на клетках человеческой нейробластомы (рисунок 2). 

Рисунок 2. (Слева) клетка нейробластомы человека с собранными флуоресцентными белкакми, пришитыми к двум модельным взаимодействующим молекулам, которые скапливаются в митохондриях. Светятся в основном митохондрии. (Справа) бактерии, в которых собрался разделенный флуоресцентный белок. Источник: ACS Synthetic Biology. Copyright (2021) American Chemical Society 

Полученный инструмент позволит исследовать межбелковые взаимодействия в анаэробных условиях и обеспечит основу для дальнейшего развития флуоресцентных и оптогенетических инструментов на основе доменов LOV.

Фото. Белки в чашке Петри. Фотограф: Анна Юденко

Производство белка – Принципы биологии

Белки – одна из самых распространенных органических молекул в живых системах, обладающая невероятно разнообразным набором функций. Белки используются для:

  • Строить структуры внутри клетки (например, цитоскелет)
  • Регулировать производство других белков путем контроля синтеза белка
  • Проведите по цитоскелету, чтобы вызвать сокращение мышц
  • Транспортные молекулы через клеточную мембрану
  • Ускорение химических реакций (ферменты)
  • Действовать как токсины

Каждая клетка живой системы может содержать тысячи различных белков, каждый из которых выполняет уникальную функцию.Их структуры, как и их функции, сильно различаются. Однако все они представляют собой полимеры аминокислот, расположенных в линейной последовательности ( Рисунок 1 ).

Функции белков очень разнообразны, потому что они состоят из 20 различных химически различных аминокислот, которые образуют длинные цепи, и аминокислоты могут быть в любом порядке. Функция белка зависит от формы белка. Форма белка определяется порядком аминокислот. Белки часто состоят из сотен аминокислот и могут иметь очень сложную форму, потому что существует очень много различных возможных порядков для 20 аминокислот!

Рисунок 1 Структура белка.Цветные шары в верхней части диаграммы представляют собой разные аминокислоты. Аминокислоты – это субъединицы, которые соединяются рибосомой с образованием белка. Затем эта цепочка аминокислот складывается, образуя сложную трехмерную структуру. (Предоставлено: Lady of Hats из Википедии; общественное достояние)

Вопреки тому, во что вы можете верить, белки обычно не используются клетками в качестве источника энергии. Белок из вашего рациона расщепляется на отдельные аминокислоты, которые собираются вашими рибосомами в белки, которые нужны вашим клеткам.Рибосомы не производят энергию.

Рисунок 2 Примеры продуктов с высоким содержанием белка. («Белок» Национального института рака находится в открытом доступе)

Информация для производства белка закодирована в ДНК клетки. При производстве белка создается копия ДНК (называемая мРНК), и эта копия переносится на рибосому. Рибосомы считывают информацию в мРНК и используют эту информацию для сборки аминокислот в белок. Если белок будет использоваться в цитоплазме клетки, рибосома, создающая белок, будет свободно плавать в цитоплазме.Если белок будет нацелен на лизосому, стать компонентом плазматической мембраны или секретироваться вне клетки, белок будет синтезироваться рибосомой, расположенной на шероховатом эндоплазматическом ретикулуме (RER). После синтеза белок будет перенесен в везикуле от RER к цис грани Гольджи (сторона, обращенная внутрь клетки). По мере того, как белок проходит через Гольджи, его можно модифицировать. Как только последний модифицированный белок завершен, он выходит из Гольджи в пузырьке, который отрастает от поверхности trans .Оттуда везикула может быть нацелена на лизосому или на плазматическую мембрану. Если везикула сливается с плазматической мембраной, белок станет частью мембраны или будет выброшен из клетки.

Рисунок 3 Схема эукариотической клетки. (Фото: Mediran, Wikimedia, 14 августа 2002 г.)

Инсулин

Инсулин – это белковый гормон, который вырабатывается определенными клетками поджелудочной железы, называемыми бета-клетками. Когда бета-клетки чувствуют, что уровень глюкозы (сахара) в кровотоке высок, они производят белок инсулина и выделяют его вне клеток в кровоток.Инсулин дает клеткам сигнал поглощать сахар из кровотока. Клетки не могут усваивать сахар без инсулина. Белок инсулина сначала образуется в виде незрелой, неактивной цепи аминокислот (препроинсулин – см. Рисунок 4). Он содержит сигнальную последовательность, которая направляет незрелый белок в грубый эндоплазматический ретикулум, где он принимает правильную форму. Затем нацеливающая последовательность отрезается от аминокислотной цепи с образованием проинсулина. Этот обрезанный, свернутый белок затем отправляется к Гольджи внутри пузырька.В системе Гольджи из белка удаляется больше аминокислот (цепь C), чтобы произвести окончательный зрелый инсулин. Зрелый инсулин хранится в специальных пузырьках до тех пор, пока не будет получен сигнал для его попадания в кровоток.

Рисунок 4 Созревание инсулина. (Фотография предоставлена ​​консорциумом Beta Cell Biology Consortium, Викимедиа. 2004 г. Это изображение находится в открытом доступе.

Если не указано иное, изображения на этой странице лицензированы OpenStax в соответствии с CC-BY 4.0.

Текст адаптирован из: OpenStax, Концепции биологии.OpenStax CNX. 18 мая 2016 г. http://cnx.org/contents/[email protected]

Структура и функции белков

Белки – очень важные молекулы, которые необходимы всем живым организмам. По сухому весу белки – самая крупная единица клеток. Белки участвуют практически во всех клеточных функциях, и каждой роли отводится отдельный тип белка, задачи которого варьируются от общей клеточной поддержки до передачи сигналов и передвижения.Всего существует семь типов белков.

Белки

  • Белки – это биомолекулы, состоящие из аминокислот, которые участвуют почти во всех клеточных действиях.
  • Происходит в цитоплазме, трансляция – это процесс, посредством которого синтезируются белков .
  • Типичный белок состоит из единственного набора из аминокислот . Каждый белок специально приспособлен для своей функции.
  • Любой белок в организме человека может быть создан из перестановок всего 20 аминокислот.
  • Существует семь типов белков: антитела , сократительные белки, ферменты, гормональные белки, структурные белки, запасные белки и транспортные белки .

Синтез белков

Белки синтезируются в организме посредством процесса, называемого трансляцией . Трансляция происходит в цитоплазме и включает преобразование генетических кодов в белки. Генетические коды собираются во время транскрипции ДНК, где ДНК расшифровывается в РНК.Затем клеточные структуры, называемые рибосомами, помогают транскрибировать РНК в полипептидные цепи, которые необходимо модифицировать, чтобы они стали функционирующими белками.

Аминокислоты и полипептидные цепи

Аминокислоты являются строительными блоками всех белков, независимо от их функции. Белки обычно представляют собой цепочку из 20 аминокислот. Человеческое тело может использовать комбинации этих 20 аминокислот для производства любого необходимого белка. Большинство аминокислот следуют структурному шаблону, в котором альфа-углерод связан со следующими формами:

  • Атом водорода (H)
  • Карбоксильная группа (-COOH)
  • Аминогруппа (-Nh3)
  • «Вариабельная» группа

Среди различных типов аминокислот «вариабельная» группа наиболее ответственна за вариации, поскольку все они имеют водородные, карбоксильные группы и связи аминогруппы.

Аминокислоты соединяются посредством синтеза дегидратации, пока не образуют пептидные связи. Когда несколько аминокислот связаны между собой этими связями, образуется полипептидная цепь. Одна или несколько полипептидных цепей, скрученных в трехмерную форму, образуют белок.

Структура белка

Структура белка может быть глобулярной или волокнистой в зависимости от его конкретной роли (каждый белок является специализированным). Глобулярные белки обычно компактны, растворимы и имеют сферическую форму.Волокнистые белки обычно имеют удлиненную форму и нерастворимы. Глобулярные и волокнистые белки могут иметь один или несколько типов белковых структур.

Существует четыре структурных уровня белка: первичный, вторичный, третичный и четвертичный. Эти уровни определяют форму и функцию белка и отличаются друг от друга степенью сложности полипептидной цепи. Первичный уровень является самым основным и рудиментарным, в то время как четвертичный уровень описывает сложные связи.

Отдельная белковая молекула может содержать один или несколько из этих уровней структуры белка, и структура и сложность белка определяют его функцию. Коллаген, например, имеет суперскрученную спиральную форму, длинную, тягучую, прочную и похожую на веревку – коллаген отлично подходит для обеспечения поддержки. Гемоглобин, с другой стороны, представляет собой сложенный и компактный глобулярный белок. Его сферическая форма полезна для маневрирования по кровеносным сосудам.

Типы белков

Всего существует семь различных типов белков, к которым относятся все белки.К ним относятся антитела, сократительные белки, ферменты, гормональные белки, структурные белки, запасные белки и транспортные белки.

Антитела

Антитела – это специализированные белки, которые защищают организм от антигенов или чужеродных захватчиков. Их способность перемещаться по кровотоку позволяет им использоваться иммунной системой для идентификации и защиты от бактерий, вирусов и других чужеродных злоумышленников в крови. Один из способов, которым антитела противодействуют антигенам, – это их иммобилизация, чтобы они могли быть уничтожены лейкоцитами.

Сократительные белки

Сократительные белки отвечают за сокращение и движение мышц. Примеры этих белков включают актин и миозин. Эукариоты, как правило, обладают обильным количеством актина, который контролирует сокращение мышц, а также процессы клеточного движения и деления. Миозин приводит в действие задачи, выполняемые актином, снабжая его энергией.

Ферменты

Ферменты – это белки, которые облегчают и ускоряют биохимические реакции, поэтому их часто называют катализаторами.Известные ферменты включают лактазу и пепсин, белки, которые известны своей ролью в заболеваниях пищеварительной системы и в специальных диетах. Непереносимость лактозы вызвана дефицитом лактазы – фермента, расщепляющего сахарную лактозу, содержащуюся в молоке. Пепсин – это пищеварительный фермент, который в желудке расщепляет белки в пище. Нехватка этого фермента приводит к расстройству пищеварения.

Другими примерами пищеварительных ферментов являются ферменты, присутствующие в слюне: амилаза слюны, калликреин слюны и лингвальная липаза – все они выполняют важные биологические функции.Амилаза слюны – это основной фермент слюны, который расщепляет крахмал на сахар.

Гормональные белки

Гормональные белки – это белки-мессенджеры, которые помогают координировать определенные функции организма. Примеры включают инсулин, окситоцин и соматотропин.

Инсулин регулирует метаболизм глюкозы, контролируя концентрацию сахара в крови в организме, окситоцин стимулирует схватки во время родов, а соматотропин – гормон роста, который стимулирует выработку белка в мышечных клетках.

Структурные белки

Структурные белки волокнистые и вязкие, что делает их идеальными для поддержки различных других белков, таких как кератин, коллаген и эластин.

Кератины укрепляют защитные покрытия, такие как кожа, волосы, иглы, перья, рога и клювы. Коллаген и эластин поддерживают соединительные ткани, такие как сухожилия и связки.

Хранение белков

Запасные белки резервируют аминокислоты для организма до тех пор, пока они не будут готовы к употреблению.Примеры запасных белков включают яичный альбумин, который содержится в яичных белках, и казеин, белок на основе молока. Ферритин – еще один белок, который хранит железо в транспортном белке, гемоглобине.

Транспортные белки

Транспортные белки – это белки-переносчики, которые перемещают молекулы из одного места в другое в организме. Гемоглобин является одним из них и отвечает за транспортировку кислорода через кровь через красные кровяные тельца. Цитохромы, другой тип транспортных белков, действуют в цепи переноса электронов как белки-переносчики электронов.

»Сколько белков в клетке?

Сколько белков в клетке?

Reader Mode

Будучи доминирующими игроками в клетке с точки зрения как биомассы, так и функциональности, белки получают большую долю внимания в исследованиях молекулярной и клеточной биологии. Тем не менее, небольшое смещение акцента на проблемы более количественного характера, связанные с этими белками, поднимает всевозможные вопросы, на которые нет ответа. Например, сколько белков в клетке? То есть общее количество белковых молекул, а не количество различных типов.Перед просмотром опубликованных измерений мы можем попытаться оценить это значение на основе свойств ячейки, которые мы, возможно, уже знаем.

Содержание белка приблизительно линейно зависит от объема или массы клетки. Учитывая, что объем клетки может изменяться в несколько раз в зависимости от условий роста или от того, какой конкретный штамм использовался, мы сначала проанализируем количество белков на единицу объема клетки (то есть числовую плотность белка), а затем умножим его на объем клетки, чтобы найти фактическое количество белков. на ячейку для интересующей ячейки.

Рисунок 1: Обратная сторона конверта расчета количества белков на объем клетки. Также дается приложение для выбранных модельных организмов на основе их характерных объемов клеток. Оценка основана на общих значениях параметров, более точные значения для конкретных организмов см. В основном тексте.

Наш первый метод оценки показан как «обратная сторона конверта», разработанный на Рисунке 1 с использованием округленных «общих» значений параметров. Оценка основана на знании массы белка на единицу объема (обозначается c p ).Единицами c p являются [г белка] / [мл объема клетки], и этот параметр был зарегистрирован для различных типов клеток. Обозначим через l aa среднюю длину белка в аминокислотах и ​​среднюю массу аминокислоты m aa . В свете этих определений количество белков в единице объема равно

.

N / V = ​​c p / (l aa * m aa ).

В E. coli и других бактериях мы используем среднюю длину белка l aa , равную 300 аминокислот на белок, а в почкующихся дрожжах, делящихся дрожжах и клетках человека мы используем большее значение, равное 400 аминокислотам на белок.Значения округлены до одной значащей цифры (с точностью около 10-20%) в соответствии с вариациями расчетных значений в литературе. Используемые средние значения длины были рассчитаны путем взвешивания длин белков по их содержанию в клетке. При этом учитываются такие проблемы, как белки с высоким содержанием, как правило, меньше, чем белки с низким содержанием.

Переходя к концентрации белка в клетках, сообщений на удивление мало, старые измеренные значения для c p равны 0.24 г / мл для E. coli и 0,28 г / мл для почкующихся дрожжей (BNID 105938, 108879, 108263, 108874). Ожидается, что значения будут аналогичными, если значения концентрации относятся либо к общему объему клеток и белкового комплемента, включая мембранно-ассоциированные белки, либо только к объему цитоплазмы и белкам). Предполагая, что средняя масса аминокислоты составляет 100 Да и с некоторыми преобразованиями единиц, мы получаем (также схематично показано с общими значениями параметров на рисунке 1)

и

Хотя это то, к чему мы стремились, читатель может задаться вопросом о том, какое значение cp мы использовали.Мы можем вывести его на основе других более известных свойств: плотности клеток, содержания воды и белковой доли сухой массы. Общая плотность клеток d составляет около 1,1 г / мл (BNID 103875, 102239, 106439). Содержание воды, которое мы обозначаем w, составляет в E. coli ≈70%, а в почкующихся дрожжах ≈60% по массе (BNID 105482, 103689). Доля белка в сухой массе p составляет ≈55% у E. coli и ≈40% у дрожжей. Связь между этими величинами: cp = d × (1-w) × p. Подставляя числа, которые мы находим,

Таблица 1: Диапазон оценок количества белков на клетку на основе различных работ.В некоторых случаях количество выводится из дополнительной информации и не указывается как таковая. Когда объем клеток не был указан в исследовании, использовались литературные значения при аналогичных условиях. * Значение общего количества белков на клетку не было явно указано и основано на суммировании значений содержания, как указано в дополнительном материале по протеому.

cp, coli = 1,1 г / мл × (1-0,7) × 0,55 = 0,19 г / мл

и

сП, дрожжи = 1,1 г / мл × (1-0,6) × 0,4 = 0,18 г / мл.

Полученные значения меньше приведенных выше на 20-40% и приводят к оценкам ≈3 × 10 6 белка / мкм 3 и ≈2 × 10 6 белка / мкм 3 в E. coli и почкующиеся дрожжи соответственно.

Теперь мы можем перейти к использованию характеристических объемов для определения количества белков на клетку, а не на единицу объема клетки. Для клетки E. coli объемом 1 мкм 3 сделать не так много, поскольку это наша единица объема клетки, и эти две оценки дают диапазон 2–4 миллионов белков на клетку.Для клеток почкующихся дрожжей размером 40 мкм 3 (гаплоид, BNID 100430, 100427) две оценки дают диапазон 90–140 миллионов белков на клетку. Экстраполируя эти плотности белков на клетки млекопитающих, прогнозируется значение примерно 10 10 белков на клетку для характерных клеточных линий, которые имеют средний объем 2000-4000 мкм 3 .

Как эти значения соотносятся с предыдущими сообщениями в литературе? В таблице 1 представлены значения, основанные на опубликованных исследованиях протеома.Примечательно, что во многих случаях общая сумма по всем белкам не сообщалась и была выведена для наших целей путем суммирования всех измеренных количеств. Некоторые из общих сумм соответствуют приведенным выше общим оценкам, в основном по бактериям. Напротив, многие значения для эукариотических клеток, включая клетки дрожжей и млекопитающих, в 10 раз ниже, чем предполагалось. Остается выяснить, связано ли это кажущееся несоответствие с проблемами калибровки в масс-спектрометрических исследованиях, в которых они были измерены, или неточностями в значениях параметров, используемых в оценке (Р.Milo, Bioessays 35: 1050, 2013). Мы рассматриваем это как указание на то, что существует постоянная проблема для тщательного анализа, чтобы получить окончательные ответы для тех, кто заинтересован в количественном отображении содержимого ячейки.

80932 Всего просмотров 41 просмотров сегодня

Протеиновый фолдинг: хорошее, плохое и уродливое

Мы часто думаем о белках как о питательных веществах в пище, которые мы едим, или как о главном компоненте мышц, но белки также представляют собой микроскопические молекулы внутри клеток, которые выполняют разнообразные и жизненно важные функции.Завершив проект “Геном человека”, ученые обращают свое внимание на “протеом” человека – каталог всех человеческих белков. Эта работа показала, что мир белков увлекателен, он полон молекул с такими замысловатыми формами и точными функциями, что они кажутся почти фантастическими.

Функция белка зависит от его формы, и, когда образование белка идет не так, получаемые в результате деформированные белки вызывают проблемы, которые варьируются от плохих, когда белки пренебрегают своей важной работой, до уродливых, когда они образуют липкую комковатую массу внутри клеток.Текущие исследования показывают, что мир белков далек от первозданного. Образование белка – это процесс, подверженный ошибкам, и ошибки на этом пути были связаны с рядом заболеваний человека.

Большой мир белков:

В типичной человеческой клетке содержится от 20 000 до более чем 100 000 уникальных типов белков. Почему так много? Белки – это рабочие лошадки клетки. Каждый мастерски выполняет конкретную задачу. Некоторые из них являются структурными, например, придают жесткость и жесткость мышечным клеткам или длинным тонким нейронам.Другие связываются с определенными молекулами и доставляют их в новые места, а третьи катализируют реакции, которые позволяют клеткам делиться и расти. Такое разнообразие и специфичность функций стало возможным благодаря, казалось бы, простому свойству белков: они сворачиваются.

Белки складываются в функциональную форму

Белок начинается в клетке как длинная цепочка, состоящая в среднем из 300 строительных блоков, называемых аминокислотами. Существует 22 различных типа аминокислот, и их порядок определяет, как белковая цепь будет складываться сама по себе.При складывании первыми обычно образуются конструкции двух типов. Некоторые области белковой цепи сворачиваются в тонкие образования, называемые «альфа-спиралями», в то время как другие области складываются в зигзагообразные узоры, называемые «бета-листами», которые напоминают складки бумажного веера. Эти две структуры могут взаимодействовать, образуя более сложные структуры. Например, в одной структуре белка несколько бета-листов обвиваются вокруг себя, образуя полую трубку с несколькими альфа-спиралями, выступающими из одного конца. Трубка короткая и приземистая, так что общая структура напоминает змей (альфа-спирали), выходящих из банки (бета-листовая трубка).Несколько других белковых структур с описательными названиями включают «бета-ствол», «бета-пропеллер», «альфа / бета-подкову» и «складку желе-ролла».

Эти сложные структуры позволяют белкам выполнять свою разнообразную работу в клетке. Белок «змеи в банке», будучи встроенным в клеточную мембрану, создает туннель, который позволяет входить и выходить из клеток. Другие белки образуют формы с карманами, называемыми «активными центрами», которые идеально подходят для связывания с определенной молекулой, например, с замком и ключом.Сворачиваясь в различные формы, белки могут выполнять очень разные роли, несмотря на то, что они состоят из одних и тех же основных строительных блоков. Чтобы провести аналогию, все автомобили сделаны из стали, но обтекаемая форма гоночного автомобиля побеждает в гонках, в то время как автобус, самосвал, кран или дзамбони имеют форму для выполнения своих уникальных задач.

Почему иногда происходит сбой сворачивания белка?

Сворачивание позволяет белку принимать функциональную форму, но это сложный процесс, который иногда терпит неудачу. Сворачивание белка может пойти не так по трем основным причинам:

1: Человек может обладать мутацией, которая изменяет аминокислоту в белковой цепи, что затрудняет поиск конкретным белком его предпочтительной складки или «нативного» состояния.Это касается наследственных мутаций, например, приводящих к муковисцидозу или серповидно-клеточной анемии. Эти мутации расположены в последовательности ДНК или «гене», кодирующем один конкретный белок. Следовательно, эти типы унаследованных мутаций влияют только на этот конкретный белок и связанные с ним функции.

2: С другой стороны, нарушение сворачивания белков можно рассматривать как продолжающийся и более общий процесс, который влияет на многие белки. Когда создаются белки, машина, считывающая указания ДНК для создания длинных цепочек аминокислот, может делать ошибки.По оценкам ученых, этот механизм, рибосома, допускает ошибки в 1 из каждых 7 белков! Эти ошибки могут снизить вероятность правильного сворачивания полученных белков.

3: Даже если аминокислотная цепь не имеет мутаций или ошибок, она все равно может не достичь своей предпочтительной складчатой ​​формы просто потому, что белки не складываются правильно в 100% случаев. Сворачивание белка становится еще более трудным, если условия в клетке, такие как кислотность и температура, изменяются от тех, к которым привык организм.

Нарушение сворачивания белка вызывает несколько известных заболеваний, и ученые предполагают, что многие другие болезни могут быть связаны с проблемами сворачивания. Есть две совершенно разные проблемы, которые возникают в клетках, когда их белки не сворачиваются должным образом.

Один тип проблемы, называемый «потеря функции», возникает, когда недостаточное количество определенного белка сворачивается должным образом, вызывая нехватку «специализированных работников», необходимых для выполнения конкретной работы. Например, представьте, что правильно сложенный белок имеет идеальную форму, чтобы связывать токсин и расщеплять его на менее токсичные побочные продукты.Без достаточного количества правильно сложенного белка токсин будет накапливаться до разрушительного уровня. В качестве другого примера, белок может отвечать за метаболизм сахара, так что клетка может использовать его для получения энергии. Клетка будет расти медленно из-за недостатка энергии, если в ее функциональном состоянии будет недостаточно белка. Причина, по которой клетка заболевает, в этих случаях связана с нехваткой одного специфического, правильно сложенного функционального белка. Муковисцидоз, болезнь Тея-Сакса, синдром Марфана и некоторые формы рака являются примерами заболеваний, которые возникают, когда один тип белка не может выполнять свою работу.Кто знал, что один тип белка из десятков тысяч может быть настолько важен?

Белки, которые сворачиваются неправильно, также могут повлиять на здоровье клетки независимо от функции белка. Когда белки не могут свернуться в свое функциональное состояние, полученные неправильно свернутые белки могут принимать форму, неблагоприятную для переполненной клеточной среды. Большинство белков содержат липкие, «ненавидящие воду» аминокислоты, которые они закапывают глубоко внутри своего ядра. Неправильно свернутые белки носят эти внутренние части снаружи, как леденцы в шоколаде, раздавленные, чтобы обнажить липкую карамельную серединку.Эти неправильно свернутые белки часто слипаются, образуя сгустки, называемые «агрегатами». Ученые предполагают, что накопление неправильно свернутых белков играет роль в нескольких неврологических заболеваниях, включая болезнь Альцгеймера, Паркинсона, Хантингтона и болезнь Лу Герига (БАС), но ученые все еще работают над тем, чтобы выяснить, как именно эти неправильно свернутые липкие молекулы наносят ущерб клеткам. .

Один неправильно свернутый белок выделяется среди остальных и заслуживает особого внимания. «Прионный» белок при болезни Крейтцфельдта-Якоба, также известной как болезнь коровьего бешенства, является примером неправильно свернутого белка.Этот белок не только необратимо неправильно свернут, но и превращает другие функциональные белки в свое скрученное состояние.

Как наши клетки защищаются от неправильно свернутых белков?

Недавние исследования показывают, что неправильная укладка белков часто происходит внутри клеток. К счастью, клетки привыкли справляться с этой проблемой и имеют несколько систем для повторного укладки или разрушения аберрантных белковых образований.

Шапероны – одна из таких систем. Правильно названные, они сопровождают белки в процессе сворачивания, улучшая шансы белка на правильное сворачивание и даже позволяя некоторым неправильно свернутым белкам возможность повторно укладываться.Интересно, что шапероны сами по себе являются белками! Есть много разных типов шаперонов. Некоторые специально предназначены для того, чтобы помочь одному типу белка сворачиваться, в то время как другие действуют в более общем плане. Некоторые шапероны имеют форму больших полых камер и обеспечивают белкам безопасное пространство, изолированное от других молекул, в котором они могут складываться. Производство нескольких шаперонов увеличивается, когда клетка сталкивается с высокими температурами или другими условиями, затрудняющими сворачивание белка, таким образом, эти шапероны получили прозвище «белки теплового шока».”

Другая линия защиты клеток от неправильно свернутых белков называется протеасомой. Если неправильно свернутые белки задерживаются в клетке, они будут уничтожены этой машиной, которая пережевывает белки и выплевывает их в виде небольших фрагментов аминокислот. Протеасома похожа на центр переработки, позволяя клетке повторно использовать аминокислоты для производства большего количества белков. Сама протеасома – это не один белок, а множество действующих вместе. Белки часто взаимодействуют с образованием более крупных структур с важными клеточными функциями.Например, хвост спермы человека представляет собой структуру, состоящую из многих типов белков, которые работают вместе, образуя сложный роторный двигатель, который продвигает сперму вперед.

Будущие исследования сворачивания и неправильного сворачивания белков:

Почему некоторые неправильно свернутые белки способны уклоняться от таких систем, как шапероны и протеасома? Как липкие неправильно свернутые белки могут вызывать перечисленные выше нейродегенеративные заболевания? Некоторые белки неправильно складываются чаще, чем другие? Эти вопросы находятся в авангарде текущих исследований, направленных на понимание основ биологии белков и болезней, которые возникают в результате неправильного сворачивания белка.

Обширный мир белков с большим разнообразием форм наделяет клетки способностями, которые позволяют жизни существовать и допускают ее разнообразие (например, различия между клетками глаза, кожи, легких или сердца, а также различия между видами) . Возможно, по этой причине слово «белок» происходит от греческого слова «протас», что означает «первостепенное значение».

– Подготовлено Керри Гейлер, аспирантом 4-го курса Гарвардского факультета органической и эволюционной биологии

Белковая фабрика

Август в нашем календаре PDBe на 2020 год вдохновлен механизмами клеточного производства белка, называемыми рибосомами.Рибосомы – это очень сложные и важные структуры в клетке, которые выполняют жизненно важную роль в синтезе белка.

Белковая фабрика клетки

Каждая клетка нашего тела содержит около 10 миллиардов белков, которые позволяют нам думать, двигаться, есть, играть и делать многое другое. Их эффективное создание – это работа этих макромолекулярных машин, называемых рибосомами, которые обнаружены во всех живых клетках всех видов, от бактерий до людей.

Структура рибосомного комплекса

Глядя на рибосому, кажется, что она представляет собой запутанную мешанину белков и молекул РНК, однако на самом деле она сшита вместе с безупречной точностью.

Две субъединицы рибосомы, собранные вместе с малой и большой субъединицами, показаны серыми и бирюзовыми лентами соответственно (запись PDB 6KE0)

Криоэлектронная микроскопия и рентгеновская кристаллография показали, что рибосома состоит из двух субъединиц: малой и большой субъединиц. Каждая из этих субъединиц образует сложную сеть из нескольких молекул РНК с десятками различных белков. В 2000 году структурные биологи Венкатраман Рамакришнан, Томас А. Стейтц и Ада Э.Йонат разрешил первые кристаллические структуры рибосомы с атомным разрешением. В 2009 году этим трем исследователям была присуждена Нобелевская премия по химии за их исследования структуры и функции рибосомы, что свидетельствует о важности рибосомы.

Синтез белка

Синтез новых белков начинается в ядре, где рибосомы получают команду начать этот процесс. Участки ДНК (гены), кодирующие определенный белок, копируются на нити информационной РНК (мРНК) в процессе, называемом транскрипцией.

После завершения транскрипции ДНК в мРНК, следующим процессом является трансляция, когда эти мРНК считываются для образования белков. Каждая мРНК определяет порядок, в котором аминокислоты должны быть добавлены к белковой цепи в процессе ее синтеза. Если за основу берется ДНК, то масоны – это рибосомы – они строят белок, используя аминокислоты в качестве «кирпичиков».

Для создания белков две рибосомные субъединицы, малая и большая, собираются вместе, образуя полную рибосому.Он имеет сайты связывания для молекул мРНК и транспортной РНК (тРНК). Большая субъединица находится поверх маленькой субъединицы, а матрица мРНК расположена между ними. После полной сборки рибосома начинает процесс производства белка.

Производство белка

Двигаясь вдоль мРНК, рибосома считывает набор трехнуклеотидных последовательностей на мРНК, называемых кодоном, который кодирует определенную аминокислоту. ТРНК доставляет эти аминокислоты, строительные блоки белка, к рибосоме.Каждая молекула тРНК имеет два разных конца или сайта, один для связывания с определенной аминокислотой, а другой для связывания с соответствующим кодоном мРНК. Во время трансляции эти тРНК переносят аминокислоты на рибосому и присоединяются к своим комплементарным кодонам на мРНК. Впоследствии они преобразуются в правильные аминокислоты в новой белковой цепи.

Собранные аминокислоты сшиваются вместе с помощью молекул рРНК (рибосомальной РНК), которые направляют процесс создания новой белковой цепи.Повторяя этот процесс для каждой аминокислоты, весь белок строится в процессе, называемом удлинением. Растущая белковая цепь останавливается только тогда, когда она встречает стоп-кодон на мРНК. Это сигнализирует об окончании полипептидной цепи во время трансляции. Как только аминокислоты сформированы правильно, вновь синтезированная белковая цепь транспортируется либо в цитоплазму, либо в аппарат Гольджи у прокариот или эукариот, соответственно.

Ниже приведено видео с сайта YourGenome, объясняющее этот процесс.

Больше, чем протеиновый завод

Точный и быстрый перевод генетической информации критически важен для производства функциональных белков для жизнеспособности клеток.Скорость производства белка должна быть быстрой и очень точной, чтобы своевременно реагировать на изменения в окружающей среде. Поразительная точность рибосомного оборудования имеет коэффициент ошибки 1 на 1000–10 000 аминокислот. Одна рибосома в эукариотической клетке может добавлять 2 аминокислоты к белковой цепи каждую секунду, однако у прокариот рибосомы могут работать еще быстрее, добавляя к полипептиду около 20 аминокислот каждую секунду. Рибосомы потребляют большое количество энергии для синтеза белков и составляют значительную часть клеточной массы, при этом значительная часть метаболизма клетки направляется на производство рибосомных белков и РНК.

Нацелены на бактериальные рибосомы

Рибосомы присутствуют во всех формах жизни и необходимы для синтеза белка, что делает их желательной мишенью для лекарств. Большинство клинически используемых антибиотиков нацелены на рибосомы и ингибируют процесс синтеза белка, вмешиваясь в трансляцию мРНК или блокируя образование пептидных связей.

Бактериальные рибосомы – одна из основных мишеней для антибиотиков. Эти антибиотики не позволяют бактериям синтезировать собственные белки из-за ингибирования их рибосомы, которая в конечном итоге убивает бактерии.Разработка таких антибиотиков стала возможной из-за различий между бактериальными и эукариотическими рибосомами. Они различаются не только размером, но и последовательностью и структурой, что позволяет антибиотикам убивать только бактерии, подавляя их рибосомы, не затрагивая человеческие рибосомы.

В PDB доступны структуры многих антибиотиков в комплексе с рибосомами. Эти структуры с разрешением на атомарном уровне позволяют нам лучше понять механизм их действия.

Спасательные антибиотики

Антибиотики, такие как неомицин, гентамицин и стрептомицин, относятся к группе аминогликозидов, которые широко используются для лечения тяжелых инфекций брюшной полости и мочевыводящих путей. Они ингибируют малую субъединицу рибосомы, включая тетрациклины, которые блокируют связывание тРНК.

Другой широко назначаемый антибиотик, эритромицин, относится к классу натуральных продуктов. Он оказывает два эффекта на трансляцию: во-первых, предотвращает удлинение полипептидной цепи, а во-вторых, ингибирует образование большой рибосомной субъединицы.

На рисунке ниже показан ряд антибиотиков, которые нацелены на бактериальную рибосому в различных участках большой (голубовато-серый) и малой (желтый) субъединицы рибосомы.

Это изображение взято из статьи «Бактериальная рибосома как мишень для антибиотиков». Nat Rev Microbiol 3, 870–881 (2005). https://doi.org/10.1038/nrmicro1265

Ингибирование эукариотической рибосомы

Некоторые антибиотики, такие как генетицин, также называемый G418, ингибируют стадию элонгации как в прокариотических, так и в эукариотических рибосомах.Рицин, лектин (белок, связывающий углеводы), вырабатываемый семенами клещевины, является очень сильнодействующим токсином. Всего несколько крупинок очищенного порошка рицина могут убить взрослого человека. Он подавляет удлинение путем ферментативной модификации рРНК большой рибосомной субъединицы эукариот. Другим известным ингибитором трансляции эукариот является циклогексимид, который обычно используется в лабораториях для подавления синтеза белка.

Лечение рака

Биогенез рибосом, процесс создания рибосом, недавно стал эффективной мишенью в терапии рака.Несколько соединений, ингибирующих продукцию или функцию рибосом, преимущественно убивающих раковые клетки, прошли клинические испытания. Недавние исследования показывают, что клетки экспрессируют гетерогенные популяции рибосом и что состав рибосом может играть ключевую роль в онкогенезе, открывая новые терапевтические возможности.

Об изображении

Два произведения искусства, керамическая скульптура (слева) и кусок шелкового батика (справа), были созданы Шином Галаутом и Мари Бишофс, 13-летними учениками Школы Персе и Колледжа Импингтон Вилладж, соответственно.Оба художника черпали вдохновение из комплексов белков и нуклеиновых кислот в базе данных PDB, а их работы основывались на процессе синтеза белка и рибосомах.

Дипти Гупта

мембранных белков | BioNinja

Понимание:

• Мембранные белки разнообразны с точки зрения структуры, положения в мембране и функции


Фосфолипидные бислои залиты белками, которые могут быть постоянно или временно прикреплены к мембране

  • Интегральные белки постоянно прикреплены к мембране и обычно являются трансмембранными (они охватывают бислой)
  • Периферические белки временно присоединяются за счет нековалентных взаимодействий и связываются с одной поверхностью мембраны

Структура мембранных белков

Аминокислоты мембранного белка локализованы в соответствии с полярностью:

  • Неполярные (гидрофобные ) аминокислоты непосредственно связаны с липидным бислоем
  • Полярные (гидрофильные) аминокислоты расположены внутри и обращены к водным растворам

Трансмембранные белки обычно имеют одну из двух третичных структур:

  • Одинарные спирали / спиральные пучки
  • Бета-баррели ( общее в канале про teins)

Мембранные белковые структуры

Функции мембранных белков

Мембранные белки могут выполнять множество ключевых функций:

  • J Unctions – Служат для соединения и соединения двух клеток вместе
  • E – Фиксация ферментов мембраны локализуют метаболические пути
  • T ransport – отвечает за облегчение диффузии и активный транспорт
  • R ecognition – может функционировать как маркеры для клеточной идентификации
  • A nchoment points внеклеточный матрикс
  • T трансдукция – Функция как рецепторы для пептидных гормонов


Мнемоника: Jet Rat


Функции мембранного белка

Роль мембранных белков в физиологии

Мембранные белки – это белки, которые являются частью клеточных мембран или взаимодействуют с ними, и они несут ответственность за выполнение большинства функций этих мембран.Мембранные белки составляют примерно одну треть белков человека и отвечают за регулирование процессов, которые помогают биологическим клеткам выжить.

Изображение предоставлено: sciencepics / Shutterstock.com

Мембранные белки имеют ряд различных структур и также расположены в разных областях мембраны. Они выполняют широкий спектр функций, и количество белков и типы белков, присутствующих на конкретной мембране, могут варьироваться.

Структура мембранного белка

Клеточные мембраны состоят из двух фосфолипидных бислоев, которые называются листочками.Эти листочки присутствуют на всех клетках, образуя барьер, окружающий каждую клетку. Мембранные белки находятся на этих бислоев фосфолипидов или они взаимодействуют с этими бислоями фосфолипидов.

Внутри липидного бислоя находятся неполярные мембранные белки, которые являются гидрофобными (водоотталкивающими), и полярные мембранные белки, которые являются гидрофильными (способны смешиваться с водой). Они напрямую связаны с липидными бислоями, которые создают барьер вокруг каждой клетки.

Интегральные мембранные белки прочно закреплены на мембране.

Белки периферической мембраны не являются постоянной частью мембраны и могут иметь гидрофобные, электростатические и другие нековалентные взаимодействия с мембраной или интегральными белками.

Интегральные белки бывают разных типов, таких как монотопные, битопические, политопные, липидно-заякоренные белки или трансмембранные белки.

Монотопные интегральные белки прикреплены только к одному из двух листочков клетки.

Интегральные белки Bitopic – это трансмембранные белки, которые могут однажды покрывать липидные бислои.Политопные белки также являются трансмембранными белками, которые охватывают липидные бислои более одного раза.

Заякоренный липидом белок имеет ковалентную связь с липидами, которые встроены в фосфолипидный бислой.

Функции мембранного белка

Существует множество функций, которые выполняют мембранные белки. К ним относятся:

  • Соединения: соединение двух ячеек вместе

Ферментативные функции

Все ферменты представляют собой белок.В результате мембранный белок, внедренный в мембрану, иногда может быть ферментом, активный сайт которого может быть обращен к веществам за пределами липидного бислоя.

Эти типы ферментативных мембранных белков могут работать в группах для выполнения определенных этапов метаболизма, например, расщепления лактозы на углеводы, а затем на моносахариды.

Транспорт

Мембранные белки могут позволить гидрофильным молекулам проходить через клеточную мембрану.Белки транспортной мембраны бывают разных форм, и некоторым требуется энергия для изменения формы и активного перемещения молекул и других веществ через клеточную мембрану. Они делают это, высвобождая АТФ для использования в качестве источника энергии.

  • Крепление: становятся точками прикрепления цитоскелета и внеклеточного матрикса

Передача сигнала

Некоторые мембранные белки могут иметь сайт связывания. Эти сайты связывания имеют особую форму, которая соответствует форме химического посредника.Например, эти химические посланники могут быть гормонами.

Когда гормон встречается с клеточной стенкой, он соединяется с рецепторным мембранным белком, встроенным в клеточную стенку. Гормон может изменить рецепторный белок и вызвать определенную реакцию, в зависимости от типа гормона или другого вещества, которая будет иметь место внутри клетки.

Распознавание клеток

Другая важная функция мембранных белков – идентификация и распознавание между клетками.Эта конкретная функция полезна для иммунной системы, поскольку она помогает организму распознавать чужеродные клетки, например, которые могут вызывать инфекцию. Гликопротеины – это один из типов мембранных белков, которые могут распознавать клетки.

Межклеточное соединение

Соседние клетки могут иметь мембранные белки, которые соединяются в различных соединениях. Щелевые и плотные соединения.

Эта функция помогает клеткам общаться друг с другом и передавать материалы между собой.

Приложение

Мембранные белки важны для цитоскелета, системы нитей и волокон в цитоплазме клетки и внеклеточного матрикса (ECM), который представляет собой сеть макромолекул, находящихся вне клеток, таких как коллаген, ферменты и гликопротеины. к мембранным белкам.

Прикрепление нитей или волокон в цитоплазме по всей клетке может помочь клетке сохранять свою особую форму. Он также сохраняет стабильное расположение мембранных белков.

Присоединение мембранных белков к внеклеточному матриксу может помочь ЕСМ опосредовать изменения, происходящие во внеклеточной и внутриклеточной среде.

Мембранные белки при болезнях

Некоторые заболевания связаны с мутациями мембранных белков. Одним из примеров является мутация под названием V509A, обнаруженная в рецепторе тиреотропина, причем тиреотропин является гормоном, секретируемым гипофизом, который регулирует выработку гормонов щитовидной железы.

Эта мутация увеличивает активность рецептора тиреотропина и приводит к врожденному гипертиреозу, состоянию, которое может вызывать изменения настроения, проблемы со сном и проблемы с желудком.

Другие заболевания, связанные с мутациями в мембранных белках, включают наследственную глухоту, болезнь Шарко-Мари-Тута, которая повреждает периферические нервы за пределами центральной нервной системы, и синдром Дежерина-Соттаса, который влияет на способность человека двигаться.

Изображение предоставлено: Explode / Shutterstock.com

Сводка

Мембранные белки выполняют ряд важных функций, которые помогают клеткам общаться, поддерживать свою форму, выполнять изменения, вызванные химическими посредниками, а также транспортировать и обмениваться материалами.

Мембранные белки также могут играть роль в прогрессировании заболевания, поскольку иммунная система может использовать мембранные белки для идентификации потенциально вредных чужеродных молекул в организме.

Related Posts

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *

2021 © Все права защищены.